Paralogue Annotation for RYR2 residue 2570

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2570
Reference Amino Acid: E - Glutamate
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2570

No paralogue variants have been mapped to residue 2570 for RYR2.



RYR2HHASLIDSLLHTVYRLSKGCSLTKAQRDSI>E<VCLLSICGQLRPSMMQHLLRRLVFDVPLLN2600
RYR1HRAIMVDSMLHTVYRLSRGRSLTKAQRDVI>E<DCLMSLCRYIRPSMLQHLLRRLVFDVPILN2634
RYR3HCTSLIDSTLQTIYRLSKGRSLTKAQRDTI>E<ECLLAICNHLRPSMLQQLLRRLVFDVPQLN2497
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E2570Kc.7708G>A Putative BenignSIFT: deleterious
Polyphen: probably damaging