Paralogue Annotation for RYR2 residue 264

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 264
Reference Amino Acid: G - Glycine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 264

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1G248RMalignant hyperthermiaHigh9 1354642, 19648156, 20461000, 23422674, 9334205, 9873004, 25525159
RYR1G248RMalignant hyperthermiaHigh9 18564801, 20461000, 23422674, 9334205, 9873004, 25525159

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2LRLLHGHMDECLTVPSGEHGEEQRRTVHYE>G<GAVSVHARSLWRLETLRVAWSGSHIRWGQP294
RYR1LRLFHGHMDECLTISPAD-SDDQRRLVYYE>G<GAVCTHARSLWRLEPLRISWSGSHLRWGQP278
RYR3VRLFHGH-DECLTIPSTDQNDSQHRRIFYE>A<GGAGTRARSLWRVEPLRISWSGSNIRWGQA283
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Gly264Argc.790G>C UnknownSIFT:
Polyphen: