Paralogue Annotation for RYR2 residue 2657

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2657
Reference Amino Acid: Y - Tyrosine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2657

No paralogue variants have been mapped to residue 2657 for RYR2.



RYR2WGNFGAASEEELHLSRKLFWGIFDALSQKK>Y<EQELFKLALPCLSAVAGALPPDYMESNYVS2687
RYR1WANFGVTSEEELHLTRKLFWGIFDSLAHKK>Y<DPELYRMAMPCLCAIAGALPPDYVDASYSS2721
RYR3WGSYGLAVEEELHLTEKLFWGIFDSLSHKK>Y<DPDLFRMALPCLSAIAGALPPDYLDTRITA2584
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Y2657Dc.7969T>G Putative BenignSIFT: deleterious
Polyphen: probably damaging