Paralogue Annotation for RYR2 residue 2715

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2715
Reference Amino Acid: E - Glutamate
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2715

No paralogue variants have been mapped to residue 2715 for RYR2.



RYR2YVSMMEKQSSMDSEGNFNPQPVDTSNITIP>E<KLEYFINKYAEHSHDKWSMDKLANGWIYGE2745
RYR1YSSKAEKKATVDAEGNFDPRPVETLNVIIP>E<KLDSFINKFAEYTHEKWAFDKIQNNWSYGE2779
RYR3ITATLEKQISVDADGNFDPKPINTMNFSLP>E<KLEYIVTKYAEHSHDKWACDKSQSGWKYGI2642
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E2715Dc.8145G>T Putative BenignSIFT: tolerated
Polyphen: benign