Paralogue Annotation for RYR2 residue 2721

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2721
Reference Amino Acid: I - Isoleucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2721

No paralogue variants have been mapped to residue 2721 for RYR2.



RYR2KQSSMDSEGNFNPQPVDTSNITIPEKLEYF>I<NKYAEHSHDKWSMDKLANGWIYGEIYSDSS2751
RYR1KKATVDAEGNFDPRPVETLNVIIPEKLDSF>I<NKFAEYTHEKWAFDKIQNNWSYGENIDEEL2785
RYR3KQISVDADGNFDPKPINTMNFSLPEKLEYI>V<TKYAEHSHDKWACDKSQSGWKYGISLDENV2648
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I2721Tc.8162T>C ConflictSIFT: tolerated
Polyphen: possibly damaging
ReportsUnknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510
Other Cardiac Phenotype Next-generation sequencing of 34 genes in sudden unexplained death victims in forensics and in patients with channelopathic cardiac diseases. Int J Legal Med. 2015 129(4):793-800. doi: 10.1007/s00414-014-1105-y. 25467552
p.I2721Vc.8161A>G BenignSIFT:
Polyphen: benign