Paralogue Annotation for RYR2 residue 2746

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2746
Reference Amino Acid: I - Isoleucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2746

No paralogue variants have been mapped to residue 2746 for RYR2.



RYR2KLEYFINKYAEHSHDKWSMDKLANGWIYGE>I<YSDSSKVQPLMKPYKLLSEKEKEIYRWPIK2776
RYR1KLDSFINKFAEYTHEKWAFDKIQNNWSYGE>N<IDEELKTHPMLRPYKTFSEKDKEIYRWPIK2810
RYR3KLEYIVTKYAEHSHDKWACDKSQSGWKYGI>S<LDENVKTHPLIRPFKTLTEKEKEIYRWPAR2673
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I2746Mc.8238A>G Putative BenignSIFT: tolerated
Polyphen: benign