Paralogue Annotation for RYR2 residue 2770

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2770
Reference Amino Acid: I - Isoleucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2770

No paralogue variants have been mapped to residue 2770 for RYR2.



RYR2GWIYGEIYSDSSKVQPLMKPYKLLSEKEKE>I<YRWPIKESLKTMLAWGWRIERTREGDSMAL2800
RYR1NWSYGENIDEELKTHPMLRPYKTFSEKDKE>I<YRWPIKESLKAMIAWEWTIEKAREGEEEK-2833
RYR3GWKYGISLDENVKTHPLIRPFKTLTEKEKE>I<YRWPARESLKTMLAVGWTVERTKEGEALVQ2697
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I2770Tc.8309T>C UnknownSIFT:
Polyphen:
ReportsUnknown The landscape of genetic variation in dilated cardiomyopathy as surveyed by clinical DNA sequencing. Genet Med 2014 Aug;16(8):601-8. 24503780