Paralogue Annotation for RYR2 residue 2824

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2824
Reference Amino Acid: R - Arginine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2824

No paralogue variants have been mapped to residue 2824 for RYR2.



RYR2DSMALYNRTRRISQTSQV--SVDAAHGYSP>R<AIDMSNVTLSRDLHAMAEMMAENYHNIWAK2854
RYR1EEEK--TEKKKTRKISQSAQTYDPREGYNP>Q<PPDLSAVTLSRELQAMAEQLAENYHNTWGR2888
RYR3EALVQQRENEKLRSVSQA--NQ--GNSYSP>A<PLDLSNVVLSRELQGMVEVVAENYHNIWAK2749
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R2824Wc.8470C>T Inherited ArrhythmiaLQTSSIFT:
Polyphen:
ReportsInherited ArrhythmiaLQTS Exome Analyses of Long QT Syndrome Reveal Candidate Pathogenic Mutations in Calmodulin-Interacting Genes. PLoS One. 2015 10(7):e0130329. doi: 10.1371/journal.pone.0130329. 26132555