Paralogue Annotation for RYR2 residue 2932

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2932
Reference Amino Acid: Y - Tyrosine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2932

No paralogue variants have been mapped to residue 2932 for RYR2.



RYR2AVSRGFKDLELDTPSIEKRFAYSFLQQLIR>Y<VDEAHQYILEFDGG-SRGKGEHFPYEQEIK2961
RYR1AVTRGLKDMELDSSSIEKRFAFGFLQQLLR>W<MDISQEFIAHLEAVVSSGRVEKSPHEQEIK2996
RYR3IVSRGMKDMELDASSMEKRFAYKFLKKILK>Y<VDSAQEFIAHLEAIVSSGKTEKSPRDQEIK2857
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Y2932Hc.8794T>C CardiomyopathyARVD/CSIFT:
Polyphen:
ReportsCardiomyopathyARVD/C Prevalence and significance of rare RYR2 variants in arrhythmogenic right ventricular cardiomyopathy/dysplasia: results of a systematic screening. Heart Rhythm. 2014 11(11):1999-2009. doi: 10.1016/j.hrthm.2014.07.020 25041964