Paralogue Annotation for RYR2 residue 2966

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2966
Reference Amino Acid: V - Valine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2966

No paralogue variants have been mapped to residue 2966 for RYR2.



RYR2HQYILEFDGG-SRGKGEHFPYEQEIKFFAK>V<VLPLIDQYFKNHRLYFLSAASRPLCSGGHA2996
RYR1QEFIAHLEAVVSSGRVEKSPHEQEIKFFAK>I<LLPLINQYFTNHCLYFLSTPAKVLGSGGHA3031
RYR3QEFIAHLEAIVSSGKTEKSPRDQEIKFFAK>V<LLPLVDQYFTSHCLYFLSSPLKPLSSSGYA2892
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V2966Ac.8897T>C Putative BenignSIFT: deleterious
Polyphen: possibly damaging