Paralogue Annotation for RYR2 residue 3032

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3032
Reference Amino Acid: C - Cysteine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3032

No paralogue variants have been mapped to residue 3032 for RYR2.



RYR2EMVTSLFCKLGVLVRHRISLFGNDATSIVN>C<LHILGQTLDARTVMKTGLESVKSALRAFLD3062
RYR1EMITSLFCKLAALVRHRVSLFGTDAPAVVN>C<LHILARSLDARTVMKSGPEIVKAGLRSFFE3097
RYR3EMVAGLFCKLAALVRHRISLFGSDSTTMVS>C<LHILAQTLDTRTVMKSGSELVKAGLRAFFE2958
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.C3032Gc.9094T>G Putative BenignSIFT: deleterious
Polyphen: probably damaging