Paralogue Annotation for RYR2 residue 3064

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3064
Reference Amino Acid: A - Alanine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3064

No paralogue variants have been mapped to residue 3064 for RYR2.



RYR2HILGQTLDARTVMKTGLESVKSALRAFLDN>A<AEDLEKTMENLKQGQFTHTRNQPKGVTQII3094
RYR1HILARSLDARTVMKSGPEIVKAGLRSFFES>A<SEDIEKMVENLRLGKVSQARTQVKGVGQNL3129
RYR3HILAQTLDTRTVMKSGSELVKAGLRAFFEN>A<AEDLEKTSENLKLGKFTHSRTQIKGVSQNI2990
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A3064Tc.9190G>A Putative BenignSIFT: tolerated
Polyphen: possibly damaging