Paralogue Annotation for RYR2 residue 3219

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3219
Reference Amino Acid: V - Valine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3219

No paralogue variants have been mapped to residue 3219 for RYR2.



RYR2SRERAALSLPTNVEDVCPNIPSLEKLMEEI>V<ELAESGIRYTQMPHVMEVILPMLCSYMSRW3249
RYR1PRERAILGLPNSVEEMCPDIPVLERLMADI>G<GLAESGARYTEMPHVIEITLPMLCSYLPRW3284
RYR3PRERSILGMPDTVEDMCPDIPQLEGLMKEI>N<DLAESGARYTEMPHVIEVILPMLCNYLSYW3145
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V3219Mc.9655G>A CardiomyopathySIFT: tolerated
Polyphen: benign
ReportsCardiomyopathyARVD/C Prevalence and significance of rare RYR2 variants in arrhythmogenic right ventricular cardiomyopathy/dysplasia: results of a systematic screening. Heart Rhythm. 2014 11(11):1999-2009. doi: 10.1016/j.hrthm.2014.07.020 25041964