Paralogue Annotation for RYR2 residue 3225

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3225
Reference Amino Acid: G - Glycine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3225

No paralogue variants have been mapped to residue 3225 for RYR2.



RYR2LSLPTNVEDVCPNIPSLEKLMEEIVELAES>G<IRYTQMPHVMEVILPMLCSYMSRWWEHGPE3255
RYR1LGLPNSVEEMCPDIPVLERLMADIGGLAES>G<ARYTEMPHVIEITLPMLCSYLPRWWERGPE3290
RYR3LGMPDTVEDMCPDIPQLEGLMKEINDLAES>G<ARYTEMPHVIEVILPMLCNYLSYWWERGPE3151
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G3225Sc.9673G>A Putative BenignSIFT: deleterious
Polyphen: possibly damaging