Paralogue Annotation for RYR2 residue 3308

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3308
Reference Amino Acid: N - Asparagine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3308

No paralogue variants have been mapped to residue 3308 for RYR2.



RYR2GNILKIIYNNLGIDEGAWMKRLAVFSQPII>N<KVKPQLLKTHFLPLMEKLKKKAATVVSEED3338
RYR1GNILRIIVNNLGIDEASWMKRLAVFAQPIV>S<RARPELLQSHFIPTIGRLRKRAGKVVSEEE3377
RYR3GNILKIINNNLGIDEASWMKRIAVYAQPII>S<KARPDLLRSHFIPTLEKLKKKAVKTVQEEE3234
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N3308Sc.9923A>G Putative BenignSIFT: tolerated
Polyphen: benign
ReportsPutative Benign Search for cardiac calcium cycling gene mutations in familial ventricular arrhythmias resembling catecholaminergic polymorphic ventricular tachycardia. BMC Med Genet. 2009 10:12. 19216760