Paralogue Annotation for RYR2 residue 3341

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3341
Reference Amino Acid: K - Lysine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3341

No paralogue variants have been mapped to residue 3341 for RYR2.



RYR2KPQLLKTHFLPLMEKLKKKAATVVSEEDHL>K<AEARGDMSEAELLILDEFTTLARDLYAFYP3371
RYR1RPELLQSHFIPTIGRLRKRAGKVVSEEEQL>R<LEAKAEAQEGELLVRDEFSVLCRDLYALYP3410
RYR3RPDLLRSHFIPTLEKLKKKAVKTVQEEEQL>K<ADGKGDTQEAELLILDEFAVLCRDLYAFYP3267
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K3341Rc.10022A>G BenignSIFT: tolerated
Polyphen: benign