Paralogue Annotation for RYR2 residue 3366

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3366
Reference Amino Acid: L - Leucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3366

No paralogue variants have been mapped to residue 3366 for RYR2.



RYR2EEDHLKAEARGDMSEAELLILDEFTTLARD>L<YAFYPLLIRFVDYNRAKWLKEPNPEAEELF3396
RYR1EEEQLRLEAKAEAQEGELLVRDEFSVLCRD>L<YALYPLLIRYVDNNRAQWLTEPNPSAEELF3435
RYR3EEEQLKADGKGDTQEAELLILDEFAVLCRD>L<YAFYPMLIRYVDNNRSNWLKSPDADSDQLF3292
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L3366Fc.10096C>T Putative BenignSIFT: deleterious
Polyphen: probably damaging