Paralogue Annotation for RYR2 residue 3398

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3398
Reference Amino Acid: M - Methionine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3398

No paralogue variants have been mapped to residue 3398 for RYR2.



RYR2AFYPLLIRFVDYNRAKWLKEPNPEAEELFR>M<VAEVFIYWSKSHNFKREEQNFVVQNEINNM3428
RYR1ALYPLLIRYVDNNRAQWLTEPNPSAEELFR>M<VGEIFIYWSKSHNFKREEQNFVVQNEINNM3467
RYR3AFYPMLIRYVDNNRSNWLKSPDADSDQLFR>M<VAEVFILWCKSHNFKREEQNFVIQNEINNL3324
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M3398Lc.10192A>T Putative BenignSIFT: tolerated
Polyphen: probably damaging