Paralogue Annotation for RYR2 residue 3422

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3422
Reference Amino Acid: Q - Glutamine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3422

No paralogue variants have been mapped to residue 3422 for RYR2.



RYR2AEELFRMVAEVFIYWSKSHNFKREEQNFVV>Q<NEINNMSFLITDTKSKMSKAA-----VSDQ3447
RYR1AEELFRMVGEIFIYWSKSHNFKREEQNFVV>Q<NEINNMSFLTADNKSKMAKAGDIQSGGSDQ3491
RYR3SDQLFRMVAEVFILWCKSHNFKREEQNFVI>Q<NEINNLAFLTGDSKSKMSKAMQVKSGGQDQ3348
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q3422Hc.10266G>C Putative BenignSIFT: deleterious
Polyphen: probably damaging