Paralogue Annotation for RYR2 residue 3648

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3648
Reference Amino Acid: G - Glycine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3648

No paralogue variants have been mapped to residue 3648 for RYR2.



RYR2NLFLQGYEKSWIETEEHYFEDKLIEDLAKP>G<-AEPPEEDEGTKRVDPLHQLILLFSRTALT3677
RYR1NMFLESYKAAWILTEDHSFEDRMIDDLSKA>G<EQEEEEEEVEEKKPDPLHQLVLHFSRTALT3711
RYR3NLFLHGYQRFWIETEEYSFEEKLVQDLAKS>P<KVEEEEEEETEKQPDPLHQIILYFSRNALT3566
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G3648Vc.10943G>T Putative BenignSIFT: tolerated
Polyphen: benign