Paralogue Annotation for RYR2 residue 3654

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3654
Reference Amino Acid: E - Glutamate
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3654

No paralogue variants have been mapped to residue 3654 for RYR2.



RYR2EKSWIETEEHYFEDKLIEDLAKPG-AEPPE>E<DEGTKRVDPLHQLILLFSRTALTEKCKLEE3684
RYR1KAAWILTEDHSFEDRMIDDLSKAGEQEEEE>E<EVEEKKPDPLHQLVLHFSRTALTEKSKLDE3718
RYR3QRFWIETEEYSFEEKLVQDLAKSPKVEEEE>E<EETEKQPDPLHQIILYFSRNALTERSKLED3573
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E3654Dc.10962A>C Putative BenignSIFT: tolerated
Polyphen: benign