Paralogue Annotation for RYR2 residue 3673

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3673
Reference Amino Acid: R - Arginine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3673

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1R3707LMalignant hyperthermiaHigh9 16917943

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2LAKPG-AEPPEEDEGTKRVDPLHQLILLFS>R<TALTEKCKLEEDFLYMAYADIMAKSCHDEE3703
RYR1LSKAGEQEEEEEEVEEKKPDPLHQLVLHFS>R<TALTEKSKLDEDYLYMAYADIMAKSCHLEE3737
RYR3LAKSPKVEEEEEEETEKQPDPLHQIILYFS>R<NALTERSKLEDDPLYTSYSSMMAKSCQSGE3592
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R3673Qc.11018G>A Putative BenignSIFT:
Polyphen:
p.R3673Wc.11017C>T Inherited ArrhythmiaLQTSSIFT:
Polyphen:
ReportsInherited ArrhythmiaLQTS Exome Analyses of Long QT Syndrome Reveal Candidate Pathogenic Mutations in Calmodulin-Interacting Genes. PLoS One. 2015 10(7):e0130329. doi: 10.1371/journal.pone.0130329. 26132555