Paralogue Annotation for RYR2 residue 3734

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3734
Reference Amino Acid: R - Arginine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3734

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1R3772WMalignant hyperthermiaHigh9 19191329, 21795085, 23919265, 24091937
RYR1R3772QMyopathy, congenitalHigh9 17483490, 19645060, 23553787

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2-DGEEE-VKSFEEKEMEKQKLLYQQARLHD>R<GAAEMVLQTISASKGETGPMVAATLKLGIA3764
RYR1GEAEEEVEVSFEEKQMEKQRLLYQQARLHT>R<GAAEMVLQMISACKGETGAMVSSTLKLGIS3802
RYR3-EEDEDKEKTFEEKEMEKQKTLYQQARLHE>R<GAAEMVLQMISASKGEMSPMVVETLKLGIA3654
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

There are currently no reported variants at residue 3734 for RYR2.