Paralogue Annotation for RYR2 residue 3795

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3795
Reference Amino Acid: G - Glycine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3795

No paralogue variants have been mapped to residue 3795 for RYR2.



RYR2ILNGGNSTVQQKMLDYLKEKKDVGFFQSLA>G<LMQSCSVLDLNAFERQNKAEGLGMVTEEGS3825
RYR1ILNGGNAEVQQKMLDYLKDKKEVGFFQSIQ>A<LMQTCSVLDLNAFERQNKAEGLGMVNEDGT3863
RYR3ILNGGNAGVQQKMLDYLKEKKDAGFFQSLS>G<LMQSCSVLDLNAFERQNKAEGLGMVTEEGT3715
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G3795Sc.11383G>A Putative BenignSIFT:
Polyphen: possibly damaging