Paralogue Annotation for RYR2 residue 3802

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3802
Reference Amino Acid: V - Valine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3802

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1V3840IMalignant hyperthermiaHigh9 16917943, 25637381

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2TVQQKMLDYLKEKKDVGFFQSLAGLMQSCS>V<LDLNAFERQNKAEGLGMVTEEGS------G3826
RYR1EVQQKMLDYLKDKKEVGFFQSIQALMQTCS>V<LDLNAFERQNKAEGLGMVNEDGTVINRQNG3870
RYR3GVQQKMLDYLKEKKDAGFFQSLSGLMQSCS>V<LDLNAFERQNKAEGLGMVTEEGTLIVRERG3722
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

There are currently no reported variants at residue 3802 for RYR2.