Paralogue Annotation for RYR2 residue 3851

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3851
Reference Amino Acid: N - Asparagine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3851

No paralogue variants have been mapped to residue 3851 for RYR2.



RYR2-----GEKVLQDDEFTCDLFRFLQLLCEGH>N<SDFQNYLRTQTGNNTTVNIIISTVDYLLRV3881
RYR1INRQNGEKVMADDEFTQDLFRFLQLLCEGH>N<NDFQNYLRTQTGNTTTINIIICTVDYLLRL3925
RYR3IVRERGEKVLQNDEFTRDLFRFLQLLCEGH>N<SDFQNFLRTQMGNTTTVNVIISTVDYLLRL3777
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N3851Sc.11552A>G Putative BenignSIFT: deleterious
Polyphen: probably damaging