Paralogue Annotation for RYR2 residue 3973

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 3973
Reference Amino Acid: D - Aspartate
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 3973

No paralogue variants have been mapped to residue 3973 for RYR2.



RYR2AVVGFLHVFAHMQMKLSQDSSQIELLKELM>D<LQKDMVVMLLSMLEGNVVNGTIGKQMVDML4003
RYR1AVVGFLHVFAHMMMKLAQDSSQIELLKELL>D<LQKDMVVMLLSLLEGNVVNGMIARQMVDML4047
RYR3AVVGFLHVFANMQMKLSQDSSQIELLKELL>D<LLQDMVVMLLSLLEGNVVNGTIGKQMVDTL3899
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D3973Hc.11917G>C Inherited ArrhythmiaCPVTSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaCPVT The RYR2-encoded ryanodine receptor/calcium release channel in patients diagnosed previously with either catecholaminergic polymorphic ventricular tachycardia or genotype negative, exercise-induced long QT syndrome: a comprehensive open reading frame mutational analysis. J Am Coll Cardiol. 2009 54(22):2065-74. 19926015
Inherited ArrhythmiaCPVT New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405
p.D3973Ec.11919T>G Putative BenignSIFT: deleterious
Polyphen: probably damaging
p.D3973Nc.11917G>A Inherited ArrhythmiaCPVTSIFT:
Polyphen:
ReportsInherited ArrhythmiaCPVT Gender Differences in the Inheritance Mode of RYR2 Mutations in Catecholaminergic Polymorphic Ventricular Tachycardia Patients. PLoS One. 2015 10(6):e0131517. doi: 10.1371/journal.pone.0131517. 26114861