Paralogue Annotation for RYR2 residue 4111

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4111
Reference Amino Acid: N - Asparagine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 4111

No paralogue variants have been mapped to residue 4111 for RYR2.



RYR2EEFVKRFHEPAKDIGFNVAVLLTNLSEHMP>N<DTRLQTFLELAESVLNYFQPFLGRIEIMGS4141
RYR1EEFANRFQEPARDIGFNVAVLLTNLSEHVP>H<DPRLHNFLELAESILEYFRPYLGRIEIMGA4185
RYR3VDFVDRFHEPAKDIGFNVAVLLTNLSEHMP>N<DSRLKCLLDPAESVLNYFEPYLGRIEIMGG4037
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N4111Hc.12331A>C Putative BenignSIFT: tolerated
Polyphen: benign