Paralogue Annotation for RYR2 residue 4115

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4115
Reference Amino Acid: L - Leucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 4115

No paralogue variants have been mapped to residue 4115 for RYR2.



RYR2KRFHEPAKDIGFNVAVLLTNLSEHMPNDTR>L<QTFLELAESVLNYFQPFLGRIEIMGSAKRI4145
RYR1NRFQEPARDIGFNVAVLLTNLSEHVPHDPR>L<HNFLELAESILEYFRPYLGRIEIMGASRRI4189
RYR3DRFHEPAKDIGFNVAVLLTNLSEHMPNDSR>L<KCLLDPAESVLNYFEPYLGRIEIMGGAKKI4041
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L4115Fc.12343C>T Inherited ArrhythmiaCPVTSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaCPVT Intravenous epinephrine infusion test in diagnosis of catecholaminergic polymorphic ventricular tachycardia. J Cardiovasc Electrophysiol. 2012 23(2):194-9. doi: 10.1111/j.1540-8167.2011.02188.x 21954897