Paralogue Annotation for RYR2 residue 4144

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4144
Reference Amino Acid: R - Arginine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 4144

No paralogue variants have been mapped to residue 4144 for RYR2.



RYR2RLQTFLELAESVLNYFQPFLGRIEIMGSAK>R<IERVYFEISESSRTQWEKPQVKESKRQFIF4174
RYR1RLHNFLELAESILEYFRPYLGRIEIMGASR>R<IERIYFEISETNRAQWEMPQVKESKRQFIF4218
RYR3RLKCLLDPAESVLNYFEPYLGRIEIMGGAK>K<IERVYFEISESSRTQWEKPQVKESKRQFIF4070
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R4144Cc.12430C>T Inherited ArrhythmiaCPVTSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaCPVT Molecular genetic analysis of long QT syndrome in Norway indicating a high prevalence of heterozygous mutation carriers. Scand J Clin Lab Invest. 2008 68(5):362-8. 18752142
Inherited ArrhythmiaCPVT New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405
p.R4144Sc.12430C>A Other Cardiac PhenotypeSIFT:
Polyphen:
ReportsOther Cardiac Phenotype Next-generation sequencing of 34 genes in sudden unexplained death victims in forensics and in patients with channelopathic cardiac diseases. Int J Legal Med. 2015 129(4):793-800. doi: 10.1007/s00414-014-1105-y. 25467552