Paralogue Annotation for RYR2 residue 4155

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4155
Reference Amino Acid: S - Serine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 4155

No paralogue variants have been mapped to residue 4155 for RYR2.



RYR2VLNYFQPFLGRIEIMGSAKRIERVYFEISE>S<SRTQWEKPQVKESKRQFIFDVVNEGGEKEK4185
RYR1ILEYFRPYLGRIEIMGASRRIERIYFEISE>T<NRAQWEMPQVKESKRQFIFDVVNEGGEAEK4229
RYR3VLNYFEPYLGRIEIMGGAKKIERVYFEISE>S<SRTQWEKPQVKESKRQFIFDVVNEGGEQEK4081
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S4155Yc.12464C>A Inherited ArrhythmiaCPVTSIFT:
Polyphen:
ReportsInherited ArrhythmiaCPVT A De Novo Novel Cardiac Ryanodine Mutation (Ser4155Tyr) Associated with Catecholaminergic Polymorphic Ventricular Tachycardia. Ann Noninvasive Electrocardiol. 2013 18(6):571-6. doi: 10.1111/anec.12089. 24147812