Paralogue Annotation for RYR2 residue 4159

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4159
Reference Amino Acid: Q - Glutamine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 4159

No paralogue variants have been mapped to residue 4159 for RYR2.



RYR2FQPFLGRIEIMGSAKRIERVYFEISESSRT>Q<WEKPQVKESKRQFIFDVVNEGGEKEKMELF4189
RYR1FRPYLGRIEIMGASRRIERIYFEISETNRA>Q<WEMPQVKESKRQFIFDVVNEGGEAEKMELF4233
RYR3FEPYLGRIEIMGGAKKIERVYFEISESSRT>Q<WEKPQVKESKRQFIFDVVNEGGEQEKMELF4085
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q4159Pc.12476A>C Inherited ArrhythmiaCPVTSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaCPVT The RYR2-encoded ryanodine receptor/calcium release channel in patients diagnosed previously with either catecholaminergic polymorphic ventricular tachycardia or genotype negative, exercise-induced long QT syndrome: a comprehensive open reading frame mutational analysis. J Am Coll Cardiol. 2009 54(22):2065-74. 19926015
Inherited ArrhythmiaCPVT New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405
Inherited ArrhythmiaCPVT A novel RyR2 mutation in a 2-year-old baby presenting with atrial fibrillation, atrial flutter, and atrial ectopic tachycardia. Heart Rhythm. 2014 11(8):1480-3. doi: 10.1016/j.hrthm.2014.04.037. 24793461