Paralogue Annotation for RYR2 residue 419

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 419
Reference Amino Acid: I - Isoleucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 419

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1I403MCentral core diseaseHigh9 8220423, 11524458, 23422674, 9334205, 9873004

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2RKAIMHHEGHMDDGISLSRSQHEESRTARV>I<RSTVFLFNRFIRGLDALSKKAKA----STV445
RYR1KKAMLHQEGHMDDALSLTRCQQEESQAARM>I<HSTNGLYNQFIKSLDSFSGKPRGSGPPAGT433
RYR3RKVILHQEGHMDDGLTLQRCQREESQAARI>I<RNTTALFSQFVSGN-----NRTA----API432
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I419Fc.1255A>T Inherited ArrhythmiaCPVTSIFT: deleterious
Polyphen: possibly damaging
ReportsInherited ArrhythmiaCPVT Spectrum and frequency of cardiac channel defects in swimming-triggered arrhythmia syndromes. Circulation. 2004 110(15):2119-24. 15466642
Inherited ArrhythmiaCPVT New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405