Paralogue Annotation for RYR2 residue 4193

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4193
Reference Amino Acid: C - Cysteine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 4193

No paralogue variants have been mapped to residue 4193 for RYR2.



RYR2PQVKESKRQFIFDVVNEGGEKEKMELFVNF>C<EDTIFEMQLAAQISESDLNERSANKEESEK4223
RYR1PQVKESKRQFIFDVVNEGGEAEKMELFVSF>C<EDTIFEMQIAAQISEPEGEPETDEDEGAGA4267
RYR3PQVKESKRQFIFDVVNEGGEQEKMELFVNF>C<EDTIFEMQLASQISESDSADRPEEEEEDED4119
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.C4193Wc.12579C>G Inherited ArrhythmiaCPVTSIFT:
Polyphen:
ReportsInherited ArrhythmiaCPVT Gender Differences in the Inheritance Mode of RYR2 Mutations in Catecholaminergic Polymorphic Ventricular Tachycardia Patients. PLoS One. 2015 10(6):e0131517. doi: 10.1371/journal.pone.0131517. 26114861