Paralogue Annotation for RYR2 residue 4201

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4201
Reference Amino Acid: Q - Glutamine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 4201

No paralogue variants have been mapped to residue 4201 for RYR2.



RYR2QFIFDVVNEGGEKEKMELFVNFCEDTIFEM>Q<LAAQISESDLNERSANKEESEK-----ERP4226
RYR1QFIFDVVNEGGEAEKMELFVSFCEDTIFEM>Q<IAAQISEPEGEPETDEDEGAGAAEAGAEGA4275
RYR3QFIFDVVNEGGEQEKMELFVNFCEDTIFEM>Q<LASQISESDSADRPEEEEEDEDSSYVLEIA4127
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q4201Rc.12602A>G Inherited ArrhythmiaCPVTSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaCPVT Mutations of the cardiac ryanodine receptor (RyR2) gene in familial polymorphic ventricular tachycardia. Circulation. 2001 103(4):485-90. 11157710
Inherited ArrhythmiaCPVT Sudden death in familial polymorphic ventricular tachycardia associated with calcium release channel (ryanodine receptor) leak. Circulation. 2004 109(25):3208-14. 15197150
Inherited ArrhythmiaCPVT Enhanced store overload-induced Ca2+ release and channel sensitivity to luminal Ca2+ activation are common defects of RyR2 mutations linked to ventricular tachycardia and sudden death. Circ Res. 2005 97(11):1173-81. 16239587
Inherited ArrhythmiaCPVT New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405