Paralogue Annotation for RYR2 residue 4276

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4276
Reference Amino Acid: V - Valine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 4276

No paralogue variants have been mapped to residue 4276 for RYR2.



RYR2FALRYNILTLMRMLSLKSLKKQMKKVKKMT>V<KDMVTAFFSSYWSIFMTLLHFVASVFRGFF4306
RYR1ARVVAAAGRALRGLSYRSLRRRVRRLRRLT>A<REAATAVAALLWAAVTRAGAAGAGAAAGAL4355
RYR3ASVKRNVTDFLKRATLKNLRKQYRNVKKMT>A<KELVKVLFSFFWMLFVGLFQLLFTILGGIF4207
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V4276Mc.12826G>A Putative BenignSIFT: tolerated
Polyphen: benign