Paralogue Annotation for RYR2 residue 4298

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4298
Reference Amino Acid: V - Valine
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4298

No paralogue variants have been mapped to residue 4298 for RYR2.



RYR2MKKVKKMTVKDMVTAFFSSYWSIFMTLLHF>V<ASVFRGFFRIICSLLLGGSLVEGAKKIKVA4328
RYR1VRRLRRLTAREAATAVAALLWAAVTRAGAA>G<AGAAAGALGLLWGSLFGGGLVEGAKKVTVT4377
RYR3YRNVKKMTAKELVKVLFSFFWMLFVGLFQL>L<FTILGGIFQILWSTVFGGGLVEGAKNIRVT4229
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V4298Mc.12892G>A Inherited ArrhythmiaLQTSSIFT: tolerated
Polyphen: benign
ReportsInherited ArrhythmiaLQTS A novel mutation in the cardiac ryanodine receptor gene (RyR2) in a patient with an unequivocal LQTS. Int J Cardiol. 2011 146(2):249-50. 21126784