Paralogue Annotation for RYR2 residue 4324

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4324
Reference Amino Acid: K - Lysine
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4324

No paralogue variants have been mapped to residue 4324 for RYR2.



RYR2LLHFVASVFRGFFRIICSLLLGGSLVEGAK>K<IKVAELLANMPDPTQDEVRGDGEEGERKP-4353
RYR1AGAAGAGAAAGALGLLWGSLFGGGLVEGAK>K<VTVTELLAGMPDPTSDEVHGEQPAGPGGDA4403
RYR3LFQLLFTILGGIFQILWSTVFGGGLVEGAK>N<IRVTKILGDMPDPTQFGIHDDTMEAERAEV4255
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K4324Nc.12972G>T UnknownSIFT:
Polyphen: benign