Paralogue Annotation for RYR2 residue 4330

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4330
Reference Amino Acid: L - Leucine
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4330

No paralogue variants have been mapped to residue 4330 for RYR2.



RYR2SVFRGFFRIICSLLLGGSLVEGAKKIKVAE>L<LANMPDPTQDEVRGDGEEGERKP-LEAALP4359
RYR1GAAAGALGLLWGSLFGGGLVEGAKKVTVTE>L<LAGMPDPTSDEVHGEQPAGPGGDADGEGAS4409
RYR3TILGGIFQILWSTVFGGGLVEGAKNIRVTK>I<LGDMPDPTQFGIHDDTMEAERAEVMEPGIT4261
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L4330Vc.12988C>G Putative BenignSIFT: tolerated
Polyphen: possibly damaging