Paralogue Annotation for RYR2 residue 4504

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4504
Reference Amino Acid: M - Methionine
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4504

No paralogue variants have been mapped to residue 4504 for RYR2.



RYR2EVPESAFWKKIIAYQQKLLNYFARNFYNMR>M<LALFVAFAINFILLFYKVSTSSVVEGKE--4532
RYR1EEAGGEFWGELEVQRVKFLNYLSRNFYTLR>F<LALFLAFAINFILLFYKVSDSPPGEDDMEG4595
RYR3EAFTANFFKGLEIYQTKLLHYLARNFYNLR>F<LALFVAFAINFILLFYKVTEEPLEEETE--4443
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M4504Ic.13512G>A Inherited ArrhythmiaCPVTSIFT: tolerated
Polyphen: benign
ReportsInherited ArrhythmiaCPVT Follow-up with exercise test of effort-induced ventricular arrhythmias linked to ryanodine receptor type 2 gene mutations. Am J Cardiol. 2012 109(7):1015-9. 22221940
Inherited ArrhythmiaCPVT Denaturing HPLC-based approach for detecting RYR2 mutations involved in malignant arrhythmias. Clin Chem. 2004 50(7):1148-55. 15131021
Inherited ArrhythmiaCPVT New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405