Paralogue Annotation for RYR2 residue 4510

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4510
Reference Amino Acid: A - Alanine
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4510

No paralogue variants have been mapped to residue 4510 for RYR2.



RYR2FWKKIIAYQQKLLNYFARNFYNMRMLALFV>A<FAINFILLFYKVSTSSVVEGKE------LP4534
RYR1FWGELEVQRVKFLNYLSRNFYTLRFLALFL>A<FAINFILLFYKVSDSPPGEDDMEGSAAGDV4601
RYR3FFKGLEIYQTKLLHYLARNFYNLRFLALFV>A<FAINFILLFYKVTEEPLEEETE------DV4445
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A4510Tc.13528G>A Inherited ArrhythmiaCPVTSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaCPVT Spectrum and frequency of cardiac channel defects in swimming-triggered arrhythmia syndromes. Circulation. 2004 110(15):2119-24. 15466642
Inherited ArrhythmiaCPVT The RYR2-encoded ryanodine receptor/calcium release channel in patients diagnosed previously with either catecholaminergic polymorphic ventricular tachycardia or genotype negative, exercise-induced long QT syndrome: a comprehensive open reading frame mutational analysis. J Am Coll Cardiol. 2009 54(22):2065-74. 19926015
Inherited ArrhythmiaCPVT New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405
p.Ala4510Serc.13528G>T UnknownSIFT:
Polyphen: