Paralogue Annotation for RYR2 residue 46

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 46
Reference Amino Acid: L - Leucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 46

No paralogue variants have been mapped to residue 46 for RYR2.



RYR2TDDEVVLQCTATIHKEQQKLCLAAEGFGNR>L<CFLESTSNSKNVPPDLSICTFVLEQSLSVR76
RYR1TDDEVVLQCSATVLKEQLKLCLAAEGFGNR>L<CFLEPTSNAQNVPPDLAICCFVLEQSLSVR75
RYR3TEDEVVLQCIATIHKEQRKFCLAAEGLGNR>L<CFLEPTSEAKYIPPDLCVCNFVLEQSLSVR77
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L46Ic.136C>A Putative BenignSIFT: tolerated
Polyphen: probably damaging