Paralogue Annotation for RYR2 residue 4608

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4608
Reference Amino Acid: R - Arginine
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4608

No paralogue variants have been mapped to residue 4608 for RYR2.



RYR2LHTVISFFCIIGYYCLKVPLVIFKREKEVA>R<KLEFDGLYITEQPSEDDIKGQWDRLVINTQ4638
RYR1LHTLVAFLCIIGYNCLKVPLVIFKREKELA>R<KLEFDGLYITEQPEDDDVKGQWDRLVLNTP4710
RYR3IHTIISLVCVVGYYCLKVPLVVFKREKEIA>R<KLEFDGLYITEQPSEDDIKGQWDRLVINTP4543
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R4608Wc.13822C>T Other Cardiac PhenotypeSIFT:
Polyphen:
ReportsOther Cardiac Phenotype Cardiac channelopathy testing in 274 ethnically diverse sudden unexplained deaths. Forensic Sci Int. 2014 237:90-9. doi: 10.1016/j.forsciint.2014.01.014. 24631775
p.R4608Qc.13823G>A Inherited ArrhythmiaCPVTSIFT:
Polyphen:
ReportsInherited ArrhythmiaCPVT Cardiac evaluation of pediatric relatives in sudden arrhythmic death syndrome: a 2-center experience. Circ Arrhythm Electrophysiol. 2014 7(5):800-6. doi: 10.1161/CIRCEP.114.001818. 25194972