Paralogue Annotation for RYR2 residue 4650

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4650
Reference Amino Acid: K - Lysine
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4650

No paralogue variants have been mapped to residue 4650 for RYR2.



RYR2QPSEDDIKGQWDRLVINTQSFPNNYWDKFV>K<RKVMDKYGEFYGRDRISELLGMDKAALDFS4680
RYR1QPEDDDVKGQWDRLVLNTPSFPSNYWDKFV>K<RKVLDKHGDIYGRERIAELLGMDLATLEIT4752
RYR3QPSEDDIKGQWDRLVINTPSFPNNYWDKFV>K<RKVINKYGDLYGAERIAELLGLDKNALDFS4585
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K4650Ec.13948A>G Inherited ArrhythmiaCPVTSIFT: deleterious
Polyphen: benign
ReportsInherited ArrhythmiaCPVT Contribution of inherited heart disease to sudden cardiac death in childhood. Pediatrics. 2007 120(4):e967-73. 17908752
Inherited ArrhythmiaCPVT The RYR2-encoded ryanodine receptor/calcium release channel in patients diagnosed previously with either catecholaminergic polymorphic ventricular tachycardia or genotype negative, exercise-induced long QT syndrome: a comprehensive open reading frame mutational analysis. J Am Coll Cardiol. 2009 54(22):2065-74. 19926015
Inherited ArrhythmiaCPVT New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405
Inherited ArrhythmiaCPVT RNA splicing. The human splicing code reveals new insights into the genetic determinants of disease. Science. 2015 347(6218):1254806. doi: 10.1126/science.1254806. 25525159