Paralogue Annotation for RYR2 residue 4706

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4706
Reference Amino Acid: Q - Glutamine
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4706

No paralogue variants have been mapped to residue 4706 for RYR2.



RYR2ALDFSDAREKKKPKKDSSLSAVLNSIDVKY>Q<MWKLGVVFTDNSFLYLAWYMTMSVLGHYNN4736
RYR1TLEITAHNER-KPNPPPGLLTWLMSIDVKY>Q<IWKFGVIFTDNSFLYLGWYMVMSLLGHYNN4807
RYR3ALDFSPVEET-KA-EAASLVSWLSSIDMKY>H<IWKLGVVFTDNSFLYLAWYTTMSVLGHYNN4639
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q4706Hc.14118G>C Putative BenignSIFT: tolerated
Polyphen: probably damaging