Paralogue Annotation for RYR2 residue 4790

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4790
Reference Amino Acid: R - Arginine
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4790

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1R4861CCentral core diseaseHigh9 12565913, 23553484, 26684984
RYR1R4861HCentral core diseaseHigh9 11709545, 23394784, 25521991

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2VTHNGKQLVLTVGLLAVVVYLYTVVAFNFF>R<KFYNKSEDGDTPDMKCDDMLTCYMFHMYVG4820
RYR1VTHNGKQLVMTVGLLAVVVYLYTVVAFNFF>R<KFYNKSEDEDEPDMKCDDMMTCYLFHMYVG4891
RYR3VTHNGKQLVLTVGLLAVVVYLYTVVAFNFF>R<KFYNKSEDDDEPDMKCDDMMTCYLFHMYVG4723
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R4790Qc.14369G>A Inherited ArrhythmiaCPVTSIFT: deleterious
Polyphen: benign
ReportsInherited ArrhythmiaCPVT The RYR2-encoded ryanodine receptor/calcium release channel in patients diagnosed previously with either catecholaminergic polymorphic ventricular tachycardia or genotype negative, exercise-induced long QT syndrome: a comprehensive open reading frame mutational analysis. J Am Coll Cardiol. 2009 54(22):2065-74. 19926015
Inherited ArrhythmiaCPVT New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405
Inherited ArrhythmiaCPVT Paralogue annotation identifies novel pathogenic variants in patients with Brugada syndrome and catecholaminergic polymorphic ventricular tachycardia. J Med Genet. 2014 51(1):35-44. doi: 10.1136/jmedgenet-2013-101917. 24136861