Paralogue Annotation for RYR2 residue 4824

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4824
Reference Amino Acid: G - Glycine
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4824

No paralogue variants have been mapped to residue 4824 for RYR2.



RYR2NKSEDGDTPDMKCDDMLTCYMFHMYVGVRA>G<GGIGDEIEDPAGDEYEIYRIIFDITFFFFV4854
RYR1NKSEDEDEPDMKCDDMMTCYLFHMYVGVRA>G<GGIGDEIEDPAGDEYELYRVVFDITFFFFV4925
RYR3NKSEDDDEPDMKCDDMMTCYLFHMYVGVRA>G<GGIGDEIEDPAGDPYEMYRIVFDITFFFFV4757
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G4824Rc.14470G>A Putative BenignSIFT: deleterious
Polyphen: probably damaging