Paralogue Annotation for RYR2 residue 486

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 486
Reference Amino Acid: Q - Glutamine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 486

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1Q474HCentral core diseaseHigh9 16621918, 16732084

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2LQDLIGYFHPPDEHLEHEDKQNRLRALKNR>Q<NLFQEEGMINLVLECIDRLHVYSSAAHFAD516
RYR1LQDLIIYFEPPSEDLQHEEKQSKLRSLRNR>Q<SLFQEEGMLSMVLNCIDRLNVYTTAAHFAE504
RYR3LQDLIAYFQPPEEEMRHEDKQNKLRSLKNR>Q<NLFKEEGMLALVLNCIDRLNVYNSVAHFAG503
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

There are currently no reported variants at residue 486 for RYR2.