Paralogue Annotation for RYR2 residue 4865

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4865
Reference Amino Acid: L - Leucine
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4865

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1L4936RCentral core diseaseHigh9 23919265

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2AGDEYEIYRIIFDITFFFFVIVILLAIIQG>L<IIDAFGELRDQQEQVKEDMETKCFICGIGN4895
RYR1AGDEYELYRVVFDITFFFFVIVILLAIIQG>L<IIDAFGELRDQQEQVKEDMETKCFICGIGS4966
RYR3AGDPYEMYRIVFDITFFFFVIVILLAIIQG>L<IIDAFGELRDQQEQVREDMETKCFICGIGN4798
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L4865Vc.14593C>G Inherited ArrhythmiaCPVTSIFT: tolerated
Polyphen: probably damaging
ReportsInherited ArrhythmiaCPVT Genetic background of catecholaminergic polymorphic ventricular tachycardia in Japan. Circ J. 2013 77(7):1705-13. 23595086