Paralogue Annotation for RYR2 residue 4868

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4868
Reference Amino Acid: D - Aspartate
Protein Domain: Transmembrane region


Paralogue Variants mapped to RYR2 residue 4868

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1D4939EMalignant hyperthermiaHigh9 14985404, 23558838

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2EYEIYRIIFDITFFFFVIVILLAIIQGLII>D<AFGELRDQQEQVKEDMETKCFICGIGNDYF4898
RYR1EYELYRVVFDITFFFFVIVILLAIIQGLII>D<AFGELRDQQEQVKEDMETKCFICGIGSDYF4969
RYR3PYEMYRIVFDITFFFFVIVILLAIIQGLII>D<AFGELRDQQEQVREDMETKCFICGIGNDYF4801
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

There are currently no reported variants at residue 4868 for RYR2.